DPCstruct | MC33504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 214 ± 32 aa |
| Standard deviation of domain lengths | 32.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 23.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5P1P3 | 53-258 | YDSAKAINDAKENYGYSATNESGDPINYVTSTGLSNLTDGKGYSYGFLTYGQPHGDQKSGESRYIGYTYYGEDYTNMDFPADKNAGG… |
| A0A4Q2A4E7 | 11-215 | VLISISISYATVNTEIINQVNKEIFYLYQIPEYYLQNSNSASLNENTFDQYNTFAYGDMFGTCKYSNLTNISEYRYLGKSIDNQNIP… |
| A0A1V5MPT2 | 3-229 | None |
| A0A1T5KYW8 | 188-379 | None |
| A0A7X8QQV4 | 1-221 | None |
| I7K9G1 | 71-237 | None |
| A0A4U0F581 | 1-290 | None |
| A0A4Y7RBR9 | 31-223 | None |
| A0A2L2XD76 | 1-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.