DPCstruct | MC33502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 100 ± 16 aa |
| Standard deviation of domain lengths | 16.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 57.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04727 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6B2M6 | 98-219 | YPKSFEELLCKQNGDRALWEYPFAVAGVNITFMLIQMLDLQAAKPRSLIGAVFLNLLIENDRAFDILYCITFKLMDRKWLEMHATYM… |
| A0A804PYW9 | 14-108 | DTFYLILKQKIECNHVRVRPKSLPGINFIKVLTEHEDAFDVLYCIAFEMMDAQWLAMRASYMQFKEVLKATRQQHERELSLEDLNSI… |
| A0A835GTQ2 | 203-300 | None |
| A0A0A0KVA2 | 178-271 | None |
| A0A7J7GGG4 | 209-281 | None |
| A0A6A6KV91 | 407-499 | None |
| A0A7J0GF09 | 410-497 | None |
| A0A4Y7JIS5 | 11-89 | None |
| A0A843XBP5 | 2-72 | None |
| A0A2H5PEA9 | 135-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.