DPCstruct | MC33501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2L158 | 15-100 | WSEQVEDLVTAGDTDGAISLLEALVSKIDFETNPNAFPPEAVDHLRLASALTELANLYASKDFSLKSDQLLSRASLLKQHALPSGY |
| A0A2P2L156 | 15-100 | WSEQVEDLVTAGDTDGAISLLEALVSKIDFETNPNAFPPEAVDHLRLASALTELANLYASKDFSLKSDQLLSRASLLKQHALPSGY |
| A0A287MQS7 | 27-128 | None |
| A0A811NU85 | 1-85 | None |
| A0A443NYN8 | 26-127 | None |
| A0A7N2KN02 | 1-100 | None |
| A0A835MIU2 | 17-113 | None |
| A0A804KWP2 | 11-110 | None |
| A0A200PUW8 | 36-116 | None |
| A0A2C9V1L3 | 10-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.