DPCstruct | MC3350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 18.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.61 |
| Pfam Score | 92.47 |
| Assigned Pfam label(s) | CL0287- PF07409- CL0763 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A738DXT5 | 15-103 | ALQRPEEYVCGLDDIHQAIHIILRTPRGSDPHRPLFGSNLWRYIDYPIERAIPHVVRESVEAIRMWEPRCRLLKVTPTIDGEHLTLR… |
| A0A1J5PQ93 | 13-123 | PALGELGQFVTGLDDLAQAIRIILATPKGSLPHRPDFGCSFLDVLDMPQGLGTARIIREVMESVARYEPRVKVSKVQVDTATYGLSV… |
| A0A356TQL1 | 7-122 | None |
| A0A1Y0FTB6 | 4-110 | None |
| A0A1T4MT10 | 17-141 | None |
| A0A3B0LYX1 | 2-107 | None |
| A0A1G4VC33 | 3-106 | None |
| A0A7I8DI68 | 2-93 | None |
| A0A1G0SG81 | 17-148 | None |
| A0A3C0GB69 | 8-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.