DPCstruct | MC335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 139 ± 27 aa |
| Standard deviation of domain lengths | 26.55 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060W899 | 63-186 | AVGTAAEFMLMPYGSLIIGFCCGIISTLGYIYITPFMEKYLKIQDTCGIHNLHAMPGVIGGIVGAVTAAAASEGVYGKAGLINTFDF… |
| A0A3P7ZZM5 | 10-164 | VLYPSHAVAVGICASFVSVIGHAWLSPKLEKRFKLYDTCGVHNLHGIPGILAGIFSIIFALGYEPESYGKTLYHIYPYFEGGPMEGD… |
| A0A444TJH6 | 4-150 | None |
| A0A7R8H903 | 22-116 | None |
| A0A6L5CQY4 | 117-323 | None |
| A0A834ACJ7 | 37-168 | None |
| A0A1A9XXG3 | 1-128 | None |
| T1DNL1 | 24-187 | None |
| A0A813SEJ2 | 347-463 | None |
| A0A6G0S7N2 | 148-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.