DPCstruct | MC33498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 191 ± 28 aa |
| Standard deviation of domain lengths | 27.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P1QQV0 | 455-598 | KEKLIGGVLASGFDETSCISRFQSHLYRKASPHKPSPYLIYKLRNYEELHTRCGPNTRAYTRSMMKIVNSENNGNAGMCKYLVCVPV… |
| A0A804PCN8 | 278-486 | ALLTAFVMTVPTLVVILLGGSIAGTPLVWVRTAMAGFLASKRSVGPDDLSFPYTSTRTAHDRLHGGLLAAGFDQEACHNRYQSAMYR… |
| A0A6A2YDQ3 | 2-183 | None |
| M7YMN0 | 4-172 | None |
| A0A6A6LKN6 | 322-517 | None |
| A0A6V7P8F2 | 20-264 | None |
| A0A2Z6M5Z8 | 97-259 | None |
| M4DJN2 | 38-188 | None |
| A0A6V7P624 | 474-642 | None |
| A0A3L6QPB4 | 1-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.