DPCstruct | MC33496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 197 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 91.20 |
| Assigned Pfam label(s) | CL0123- CL0129- CL0016- PF03147- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804P156 | 61-156 | NPSSVASASITQSTTATIKSDDPAWKHCYCPDLKKKHSLKCNYCDKLINAGITRVKYHLANMAGFNVSKCKKVPTPVKENMVALLTK… |
| A0A811SMK5 | 13-84 | RDACWEYCDKLDGNKVRCRFCHKVLNGGISRLKFHLSQIPSKGVNPCTKVKEDVIDKVKAIISAKEEYKEFQ |
| A0A3N7GU33 | 2-77 | None |
| A0A1Q3D4J5 | 12-102 | None |
| A0A2N9IKD5 | 1-100 | None |
| A0A2N9ILE4 | 309-386 | None |
| A0A445IXN4 | 148-220 | None |
| A0A834SC52 | 9-116 | None |
| A0A834STL4 | 6-115 | None |
| A0A3N7GLU9 | 193-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.