DPCstruct | MC33492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2SY10 | 189-309 | LILYLAMLYGIYVPDWQFAVHDKESAVYGRVFAVDCNVRGKLNPPCNAVGYIDREILGINHLYLKPAWRRAKACTDNSPYEGPFKND… |
| A0A804NSX2 | 15-109 | AITYKSLLYGIYVPDWEYQTSAPGSTEKHFFVKCGVRGDTSSGCNAVGMIDRKILGIQHLYGRPVYARSKQCSIDSPQNGPLPPDAP… |
| A0A4S4EQJ8 | 34-140 | None |
| A0A6A6M581 | 188-306 | None |
| A0A2N9GUS7 | 437-539 | None |
| A0A4Y1QPM3 | 255-372 | None |
| A0A287IEH0 | 49-164 | None |
| A0A1J6IBZ2 | 61-185 | None |
| A0A6D2I507 | 191-312 | None |
| A0A453DSE0 | 147-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.