DPCstruct | MC33483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 250 ± 44 aa |
| Standard deviation of domain lengths | 43.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G2ZRX0 | 8-281 | YAPSGAFGPLTLVYALGSLLAASLLAGLYMLLLDLIPFIYVSFLLTAGFGFGLAMLCSMSITAGHCRNRALALGLGLLVGATGLAAS… |
| A0A1L9QW51 | 14-254 | AALSGALTGISIYGAMHVFDYWTFQRAVAGELRQAYSEDLQTALAESEEGVTEEDLLQSAIDIILIEETGQAGFIGYLQFTAQRGME… |
| A0A6C2YNB3 | 28-278 | None |
| A3DCE5 | 27-189 | None |
| A0A5N1K138 | 13-304 | None |
| A0A643FB82 | 58-220 | None |
| A0A3N5SZF3 | 61-343 | None |
| A0A2E8S0M6 | 134-380 | None |
| A0A517T387 | 23-299 | None |
| A0A1K1RC44 | 6-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.