DPCstruct | MC3347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5PM66 | 1-101 | MTAGEKKDVVFTERLRTHPGKVAIYGWQRTNGLPIQPLSTVHGAFYADYSHGIRLVSNTAFVNGQPHPLSEIFQDSGLARIISAEGT… |
| A0A7V4ARY5 | 176-259 | KKDVVITNRLLERSGRVAIYGWHHPDGRPIQPLTTVHKDRYVDYSHGIRLVRRAMKVDGRDADLADVLQDPVLFALVSDEGPLK |
| A0A2G6JQ82 | 186-268 | None |
| A0A2N1U8Q6 | 295-379 | None |
| A0A6I1JTF3 | 142-224 | None |
| A0A1X7MMX7 | 1-89 | None |
| A0A5C7PV50 | 135-214 | None |
| A0A820LXK6 | 38-133 | None |
| A0A7X7IYJ7 | 397-479 | None |
| A0A4R2PUK2 | 411-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.