DPCstruct | MC33467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 317 |
|---|---|
| Mean domain length (aa) | 149 ± 29 aa |
| Standard deviation of domain lengths | 29.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.06 |
| Pfam Score | 69.32 |
| Assigned Pfam label(s) | CL0023- CL0181- CL0029- PF08352- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9SPK7 | 74-223 | LEGHVGVIRPARMGIPNQLQAIVEQVQSDGVVGLATLRLRSGDTICALIDSDECEPLGIVPGAEVLALCKATSISLARTDQEENPMK… |
| A0A7W4SV68 | 2-131 | NIRPATVVARDGGLGVEIGDTMLPLPAAYSDALGNRIGQKVQFGIRPENIGTPRSIFAAGSQERASVANCTFRLREHMGNEVYTYFD… |
| A0A523EHB4 | 87-203 | None |
| A0A2M8UMA4 | 10-162 | None |
| A0A1C4IIP9 | 825-975 | None |
| A0A359BE88 | 1-152 | None |
| A0A250KTQ9 | 129-298 | None |
| A0A7L9WTB0 | 49-191 | None |
| A0A1E4I9H1 | 7-137 | None |
| R5TAJ0 | 73-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.