DPCstruct | MC33464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 102 ± 19 aa |
| Standard deviation of domain lengths | 18.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF09836- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060NMK5 | 16-106 | WPLLCAFDPDAVLEIHLAGHQADPLIGEALWVDAHATPVSEGVWRLYQRLIERIGPRPTLIERDGDVPAFDELLQERERAQRGLQAA… |
| A0A2V2A7W7 | 73-166 | SRNHGFDPWTFIQGLPANKVRQLHLAGHSDYGDYVIDTHDHPVSDPVWALYQRTLDYLGPVATLLERDDHFPLFEELLNELQKAREL… |
| A0A7Y4YHC4 | 4-148 | None |
| A0A4Q6G5H4 | 181-282 | None |
| A0A812ZWV4 | 315-410 | None |
| Q08YT1 | 77-176 | None |
| A0A0J7Y8W1 | 65-143 | None |
| A0A7U7GCM2 | 2-80 | None |
| A0A329VX66 | 3-139 | None |
| A0A7K0F4W5 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.