DPCstruct | MC33460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 10.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9YUL6 | 159-240 | YDGDLSDINGFHVKKEHVFSALDNAKPGSVPEGNVGGGTGMVCHGFKGGIGTSSREIQIDSTTYTLGVIVQANYGSRKSLTI |
| A0A7D5UVQ1 | 1-101 | MEHAYRNFTDEKTGEMFIFPVVAETFDDYFNDQSKFAVTPEHIIRGVNKATAERVPEGNTGGGTAMLCHRYRGGTGSSSRTINGYDI… |
| A0A817MQD4 | 129-216 | None |
| A0A813Y8F8 | 142-242 | None |
| A0A0K2R5Z7 | 1-105 | None |
| A0A2R6B0Q5 | 1-82 | None |
| A0A060LTT7 | 65-135 | None |
| A0A815VZD3 | 141-213 | None |
| A0A8B0KT55 | 104-178 | None |
| A0A0D2JXF7 | 132-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.