DPCstruct | MC3346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 179 ± 24 aa |
| Standard deviation of domain lengths | 23.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A429RI32 | 223-386 | QLLEIKTSPFGDEWGPSGSDTLPVYYRCQIQWQLDTLGLKVCHVAVLIGGWDYREYVVEYDADDAQILRDAAERFLDDVRRGNRPPI… |
| A0A1J5PIQ1 | 3-182 | EYIQLQVMHQLAVTGKQAADVAVLICGQDLQIHRIERDEGMIARLVELERQFWRYVETDTAPPADGSDSADVALRCLYPHDRGQTLD… |
| A0A6J4WHL1 | 100-275 | None |
| A0A6P9AEL1 | 35-220 | None |
| A0A0J7K3D0 | 54-261 | None |
| A0A368UAZ4 | 191-391 | None |
| A0A544Y3T3 | 208-396 | None |
| A0A223S099 | 311-486 | None |
| A0A060UMJ3 | 34-215 | None |
| A0A1C5YBT5 | 78-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.