DPCstruct | MC33458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 179 ± 21 aa |
| Standard deviation of domain lengths | 21.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5ZN38 | 50-238 | GVQYEVHPDDPQYANGIGFPEEHKNLNAYDVVQMATERFRLESAMGKAFTGATTSSRAWNSMAIFLSSIGLSFVSKALGIDGAIYRI… |
| A0A6N7Q927 | 10-164 | SKTAYEFVRDANLRAMIESATGNVNVISSVVGANVLTAMTDLLQLASNYTGLRDQARIMYKVVFKDGSYVTIIVNLENQNGNTEPGS… |
| A0A0K0XVV5 | 173-326 | None |
| A0A2J0TQ66 | 36-196 | None |
| H3ZEA0 | 46-257 | None |
| A0A126NFD7 | 1-140 | None |
| A0A8B5YXD6 | 39-236 | None |
| A0A6M8VPM6 | 28-197 | None |
| A0A7W7X1G0 | 22-200 | None |
| A0A4P6VQS0 | 28-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.