DPCstruct | MC33454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 157 ± 35 aa |
| Standard deviation of domain lengths | 35.35 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.75 |
| Pfam Score | 95.27 |
| Assigned Pfam label(s) | CL0020- CL0722- CL0697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8PEB7 | 10-201 | FPAEFHSQTAVEAAVTLHSEVKDKLSEIERIEVTTHESAIRIISKVGELANPADRDHCLQYMIAVPLIHGDLIAEHYEDSFHKGDAR… |
| A0A238ZMR0 | 17-183 | RLDAARAPEPVLDRLSLVLLDVIGVTALGAGLASPRWDNRLSAMFSTPFAVAAALLHGEVGPRTSLEDPRLRALARRVRLVEADDLT… |
| A0A840T7G4 | 14-149 | None |
| A0A2H5F579 | 93-279 | None |
| A0A7X7HH91 | 1-156 | None |
| A0A507BJE2 | 1043-1229 | None |
| N4VH31 | 572-770 | None |
| A0A2X2C1N6 | 41-207 | None |
| V9XQ11 | 12-188 | None |
| A0A5N6EWI5 | 441-608 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.