DPCstruct | MC33453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 82 ± 16 aa |
| Standard deviation of domain lengths | 16.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0N6R9 | 11-75 | HPFVRELVEYGEVKGEAKAVLMILDGRKIQVPFEARRRILACTDQETLKTWIERALVATSVDELF |
| A0A238VSN5 | 14-92 | NYEWQSEFAISHRAEGRAEGRAEGEAKGEVKALLLLLEARGLAVPQEVRARVERCTDLEQIERWIQRAVSADAAEDLFT |
| A6G0R5 | 1-98 | None |
| A0A355F8T6 | 143-216 | None |
| A0A810KWV9 | 118-218 | None |
| A0A561UVZ4 | 61-146 | None |
| A0A6L5EQ94 | 49-131 | None |
| A0A7K0BTJ2 | 39-116 | None |
| A0A7X0LEN7 | 13-83 | None |
| A0A543J4P8 | 237-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.