DPCstruct | MC33450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 511 ± 95 aa |
| Standard deviation of domain lengths | 94.94 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0229- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5CA83 | 2-448 | ASRNKIFKYDNLIEVDLMASSFRENIRRFLDKKFKKQDSAKKSTWLQYVIHRTYINVGLQLYVVEDTNQNQHCVHCLKMGWNSSLLT… |
| A0A498IB14 | 2-512 | STTHPFSNFCSGPHRFLGAFRDNVLEFVQEFDNLGEFLHGMNVWRRQLTVEGQGVTVPLYIIEEDVKKLSKRQTCDHCRITGWSKHL… |
| A0A2U1MVK7 | 1-517 | None |
| A0A484KWB0 | 326-853 | None |
| A0A2G5DU39 | 2-506 | None |
| A0A2P2MM24 | 8-429 | None |
| A0A7N0UAT1 | 1-348 | None |
| A0A4S4DHK0 | 2-482 | None |
| A0A4P1R8C1 | 601-1106 | None |
| A0A287NCF5 | 1-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.