DPCstruct | MC3345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5PGD6 | 16-103 | YKIECPTNSGNFMTLQQVAHELYNRVSNLFLKDKDGKRAVFGHYTKMQTDPHFKDYILFHEYFDGDNGRGAGASHQTGWTGLIAECLY |
| A0A1V5DY36 | 172-267 | FYLYYGDNFTIECPTGSGKRMNLYEVAKEIADRLARIFLRDESGRRPVYGGTEKFQTDPHWRDYILFYEYFHGDNGAGLGASHQTGW… |
| A0A7D8Z176 | 561-655 | None |
| A0A812TW33 | 90-195 | None |
| A0A7W1HDP7 | 19-93 | None |
| A0A0G4NBE7 | 299-398 | None |
| A0A2Z6UWR0 | 297-407 | None |
| A0A351CCT0 | 203-291 | None |
| A0A534WKT9 | 100-176 | None |
| A0A1F8M5C1 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.