DPCstruct | MC33446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 149 ± 14 aa |
| Standard deviation of domain lengths | 14.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 27.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5M055 | 3-138 | RRSGRKAYYAGDYQTCYQNFFGKELDETEQVMYSKSESILTIRMWLREYEVFVNEGSELEALDSLLQAVHDYPSLLNYATEYNAQDE… |
| R7QTS3 | 28-168 | GYSVFKGEAQDSYKQGDYVTAYAKLEGAKIKSADEDFYNRTALLAAIQEEYDSYQSMMQIGKTEMALDCLIRGVGRCDNHAEKAEEY… |
| A0A3A9EZB5 | 18-156 | None |
| A0A1H7HG11 | 922-1080 | None |
| A0A3A9D4A3 | 402-555 | None |
| D4J323 | 5-147 | None |
| A0A0K8J6V2 | 398-537 | None |
| R5WCS7 | 297-434 | None |
| A0A1D9P1F6 | 619-768 | None |
| A0A1G6AQV6 | 426-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.