DPCstruct | MC33445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 188 ± 30 aa |
| Standard deviation of domain lengths | 29.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3ZHY6 | 2-237 | PMQIAFDRLQEKEVYTKAVLLAEKHGFNEFSNYMLYNFHDTPRDLYERLVINIKLNERFIEESEKETRSGKIYSYPMRYAPIRDQGN… |
| A0A7X9FS24 | 212-394 | MAVEKHYRKAVIRLAKNGFYEFTNYLLFNCEDSPEDFFYRMSVNLELSEELGIRVTGFPMKYSPVDSVVRRYISPKWKWKYLRGIQC… |
| A0A7C3V0E2 | 143-288 | None |
| A0A0F9SLX5 | 330-480 | None |
| A0A450RZ49 | 80-257 | None |
| A0A1G0SD63 | 2-184 | None |
| A0A5M8P4G9 | 206-434 | None |
| A0A6L9GVG2 | 353-529 | None |
| A0A2M8GGJ3 | 161-343 | None |
| A0A645A7F2 | 153-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.