DPCstruct | MC33444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 196 ± 37 aa |
| Standard deviation of domain lengths | 37.14 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3ZFP7 | 14-211 | NIVQKFRRQYESVIEVFAPFVNSISPYVPARRARKLHIGLFGYSRNVAGVSLPRAITFAASLYSIGVPPEFIGAKALEDLTDEEMSL… |
| A0A0G1DTY6 | 1-130 | MPRAIAFTAVLYSLGVLPELIGSGRGLAEALKQKLPLTRFYLNFKVDIVWAGRFLNKENLELLTKINPAWRQVAEDVKLIEKNFRLK… |
| A0A7C2QAH6 | 2-167 | None |
| A0A2N2DNQ2 | 6-281 | None |
| A0A7C5VP33 | 1-167 | None |
| A0A7C4NR21 | 76-279 | None |
| A0A7J3I505 | 2-183 | None |
| A0A662UC48 | 1-185 | None |
| A0A1F9LFT8 | 792-1053 | None |
| A0A0B3A8I0 | 19-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.