DPCstruct | MC33438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 467 ± 116 aa |
| Standard deviation of domain lengths | 115.68 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 90.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.58 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | CL0023- CL0603- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402FFY9 | 1-507 | TPTPLGEGKSTVTIGLVQALTAHLKVNSFACLRQPSQGPTFGVKGGAAGGGYAQVIPMEEFNLHLTGDIHAITAANNLLAAAIDARI… |
| A0A2X1WLX8 | 1-252 | MNDRSLRNVVISLGKKADGFPREDHFMITVASEIMAVLCLAESIEDLKNRIAKMVIGYNLDGNPVTVADLEIQGAVAMLLKDALKPN… |
| A0A059D652 | 25-545 | None |
| A0A665W8F4 | 195-790 | None |
| A0A812LKM4 | 23-324 | None |
| A0A553MV03 | 336-900 | None |
| A0A6G0XHM6 | 79-627 | None |
| A0A5A9NF52 | 664-1255 | None |
| A0A498MXD7 | 166-667 | None |
| M7C472 | 54-694 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.