DPCstruct | MC33437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 57.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A670ZYE7 | 367-452 | VGNSFRGFEERLLAKVFRENYSYIAKVLEATQEEALPPHTQHPDVFNDTSVHCFPLQKLRGLPQDCWACRPEPLYPEEAQLEIIRS |
| A0A834DK45 | 179-257 | IGNSFRGLEERLLTRILQENYAYVAKVLEGLEEHAFPQTPRYMDTFNDTSVHWFPVRKLSQLSTDTWAFREEPDYRGCE |
| A0A2P8Z2E9 | 1-97 | None |
| A0A6J0W503 | 563-648 | None |
| A0A6I9XSZ8 | 148-224 | None |
| A0A4X1SIG7 | 473-558 | None |
| A0A315V896 | 198-300 | None |
| A0A803W9Q4 | 493-580 | None |
| A0A7J7S3A2 | 28-117 | None |
| L5LZI2 | 221-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.