DPCstruct | MC33436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402F797 | 15-129 | MRQFDNLFRKETGKDRVTSQSWLSTGWFTMVIAVELCDRIHVYGMVPPTYCTRKTPLPQKMPYHYYEPKGPDECFTYIHNERSLKGN… |
| A0A7M4FIN9 | 173-289 | SRHKMLQFDDLFKRETGKDRKISNTWLSTGWFTMSIAVELCDRINVYGMVPPDFCRDPNHLSVPYHYYEPFGPDECTMYISHERGRK… |
| G5BVG5 | 59-175 | None |
| A0A7J5YM54 | 835-948 | None |
| A0A3P9K598 | 138-238 | None |
| A0A498NS27 | 106-221 | None |
| A0A2K6KDZ0 | 170-285 | None |
| H0XXL3 | 1-100 | None |
| A0A673GRQ7 | 103-199 | None |
| A0A3L8SDT9 | 439-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.