DPCstruct | MC33434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 168 ± 25 aa |
| Standard deviation of domain lengths | 25.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 59.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482SGM5 | 12-161 | EVPKDFVGEGEAGEDELEEHPEEAIPDLPENQGAREFLKMAPKKGLFMPLGKEVKVMQCWRCKAFGHRTGDRECPMRMTGNATIEER… |
| A0A402F2H9 | 238-415 | GQGLERKEKRKTREVQQIQQIQHLESFYEKLPPGLIKENETKPEDCIPDVPGNENAREFLAHAPTKGLWMPLGKEVKVMQCWRCKRY… |
| F0W5U4 | 11-191 | None |
| A0A2I0UDJ1 | 21-200 | None |
| A0A6F9DYH7 | 15-183 | None |
| H0W3K2 | 2-184 | None |
| A0A2Y9PAU8 | 23-155 | None |
| A0A4W6CUZ3 | 1-147 | None |
| A0A6P4Y6X4 | 2-178 | None |
| G1KIR0 | 48-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.