DPCstruct | MC33432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 128 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367JFV5 | 14-129 | FEIAWEVANKVGGIYTVIKTKVPVTVREFGDRYTLIGPLSYKSAPMEVEACEPSNQRIKECLDSMSSHGVKYLYGRWLVEGSPYVLL… |
| A0A060CEW8 | 9-128 | LLFEVATEVANRVGGIYSVLKSKAPITVAEYKERYTLIGPLNHDSAAVEVEELQVQDPHIKATLDSMASRGIRYIYGRWLIEGAPRV… |
| A0A180GRN1 | 34-141 | None |
| A0A368GG93 | 47-163 | None |
| A0A183M0S7 | 1-201 | None |
| E9G7V4 | 54-160 | None |
| A0A2E5G2Z8 | 7-167 | None |
| K5UND3 | 367-483 | None |
| A0A0C4FCJ6 | 29-137 | None |
| A0A1C7MU22 | 14-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.