DPCstruct | MC33430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 177 ± 14 aa |
| Standard deviation of domain lengths | 14.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084S0B5 | 712-886 | YTSKERQCKLGYDSSTACDSFQLGQMIKFLASKNLLFLVDFSPASLDALADTSVSDIEQLLLTLRQTPSYQIDKHHTNCGLRIRIDP… |
| A0A1B8E6Y7 | 3-154 | YDSSAACDSFQLGEMVKFFVNKGLFSFTSPLLVTEEDYPEPYDGDIENLITALRQCPYYQYDKDHAHCGLRTRLIPALDFIQAMLAS… |
| A0A4P7NR34 | 524-694 | None |
| A0A2S4L9V9 | 692-864 | None |
| G2YJ86 | 1-206 | None |
| A0A194VUI1 | 318-506 | None |
| A0A2U3EHW4 | 679-852 | None |
| V5I023 | 619-810 | None |
| A0A0C4E7K8 | 97-265 | None |
| A0A2C5YJZ8 | 138-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.