DPCstruct | MC3343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 154 |
|---|---|
| Mean domain length (aa) | 144 ± 25 aa |
| Standard deviation of domain lengths | 24.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5P8V5 | 4-129 | ATAGAKKAFALEDARIQVDRRHQRIEYHDLTGRVRMTDSGPRVDVHIADTDTIEAGLRLSAQKFGGEVFITGEAAFREQSARQAARL… |
| A0A0F0DMZ7 | 35-164 | RRLTIRSARPVQPNAILYDGPVITHRVQRNGDVEYQRNGAALLVDQGKSVRLWQNDRDAIEIALRLAQRKFGPVLELTGPLEFQMEA… |
| A0A1E9JVJ6 | 554-714 | None |
| A0A2K4W4E8 | 1-113 | None |
| A0A1B8Q4H9 | 98-319 | None |
| A0A3S4DY75 | 46-172 | None |
| A0A7D5YUX3 | 232-403 | None |
| B7UEZ2 | 694-826 | None |
| A0A2N0DU62 | 56-168 | None |
| Y0KHP2 | 448-619 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.