DPCstruct | MC33421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0JG98 | 2-92 | KPVIMFGSGDTGATIRNAVTGEKYYGHRVGSRHEDLYFKARICTGEFIESPTLFYDSVEQYERHQYCVTDNAIRAKFAAKQRAAMAD… |
| A0A6C0HGS9 | 1-127 | MTEQIMDLSRYDGDGFENVVVTLKSMRRTGHRRYFPSNKQNSFIVNAETGIAYPWRVGSYDSRRLFKMVDTTGVCDINGFMIDRHTE… |
| A0A6C0DC98 | 24-156 | None |
| A0A6C0IDP6 | 78-207 | None |
| A0A6C0JHG9 | 1-120 | None |
| A0A6C0HDQ2 | 14-144 | None |
| A0A6C0IEQ3 | 18-130 | None |
| A0A6C0I3R9 | 1-105 | None |
| A0A6C0CKS5 | 30-165 | None |
| A0A6C0F6J8 | 6-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.