DPCstruct | MC3342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7Y3V4 | 1-77 | MEFRVNQRVRVSRDVRNDGTCSSCKSGCIVARAGDEGFVREVSEFLFRPAIMVHFLERNAVLGFREDELEIVEDYDP |
| A0A1J5P771 | 2-72 | ISRYVVRNDGTYRGREVGEVLVQKGDIGYVSSVGTFLQQYYIYAVDFVATGCLVGMKGRELMSLDNLPPEL |
| A0A3L8C2V3 | 19-104 | None |
| H6SN62 | 2-69 | None |
| G2DVW9 | 6-84 | None |
| A0A037UPE4 | 1-78 | None |
| A0A1G7HPX3 | 11-86 | None |
| A0A7V5J0G3 | 1-80 | None |
| A0A7W0AB49 | 1-103 | None |
| A0A5H2YE71 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.