DPCstruct | MC33418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1876 |
|---|---|
| Mean domain length (aa) | 155 ± 38 aa |
| Standard deviation of domain lengths | 37.81 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.97 |
| Pfam Score | 96.07 |
| Assigned Pfam label(s) | CL0023- PF05033- CL0489- CL0063- CL0278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0HDP8 | 13-168 | IHPNISFTYDNNQISTIASEPIDKGVLIMLEEGIVGKTKEVIRKMSFNEDLNALLYPRENTDNKSDFEFNRQKYNYNAFEWNEKEKT… |
| A0A1M3QGK6 | 4-118 | DFLYIDFTKDKGRGVFTRKKIKPETVIEVSPVIVMSNTERKLIDQTLLHDYIFVWGDNEDQCCMALGYIPVYNHSYQSNCEYFMDYD… |
| A0A7R9PXJ1 | 843-994 | None |
| A0A5S6QIL5 | 68-211 | None |
| A0A7R9XQY8 | 669-810 | None |
| A0A6S7FEY7 | 132-250 | None |
| C4A0M0 | 4-133 | None |
| A0A5N5THB1 | 774-873 | None |
| A0A5N5TGS5 | 28-156 | None |
| A0A061RI89 | 10-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.