DPCstruct | MC33417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 27.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0HB18 | 44-133 | FNSQELNSIREKIESMPKFNQIEVLRILSSYKNITLNENKYGVLINMTDLKKEVIEKLKEYISYVNTQETNLNEFETRIQEYKNIYF… |
| A0A6C0JBY0 | 2-91 | NMEKLNKLKNIIDNLDKIHHLKIFKVLKDNNVKFSENRNGIFINMNSFDENTIKNIELTLQYINRQEKQLLDIETIKYDLKQDFFIQ… |
| A0A6C0CSV3 | 17-121 | None |
| A0A6C0LXK5 | 6-107 | None |
| A0A6C0LT72 | 3-94 | None |
| A0A6C0GZG5 | 1-109 | None |
| A0A6C0H7Y6 | 1-88 | None |
| A0A6C0C190 | 1-82 | None |
| A0A6C0F244 | 33-115 | None |
| A0A6C0E4C6 | 10-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.