DPCstruct | MC3341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 106 ± 19 aa |
| Standard deviation of domain lengths | 19.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.62 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | PF00453- PF01632- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139JQQ6 | 10-121 | RHKRRKKVLKMAKGYFGSKKNLYKTAHEQVMRSLQYAYRDRRQKKRNFRRLWIIRINAGCKNNNISYSSFIHGLILSKIEVNRKILA… |
| A0A1J5P202 | 128-214 | GFYQAVDKANQYATRDRKTRKRNFRALWIQRINAGCRAIDPTLTYSRFINALTVTGIEVDRKVLADLAVNEPEAFGAIVAKAQAALA |
| A0A7V6GMZ6 | 5-123 | None |
| A0A1A8ZIP9 | 2-82 | None |
| A0A858ARH7 | 8-121 | None |
| A0A6H0E9H2 | 1-112 | None |
| A0A812YTP3 | 9-121 | None |
| A0A2T7DYH4 | 3-82 | None |
| A0A183TKY6 | 3-97 | None |
| A0A812PDN2 | 149-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.