DPCstruct | MC33405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 294 ± 59 aa |
| Standard deviation of domain lengths | 59.45 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 93.01 |
| Assigned Pfam label(s) | PF19533- PF13890 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P9DTI9 | 153-475 | APSDSLTYRLALCVCLEFVLELRYRWENNHLICGLAGGAPDLRCCLLHQKFQMLNCCIKRKKARDESHKVPEGKEKEHRVSGACQKS… |
| V4UN26 | 46-367 | GSFKNLRKMALFWCKVVAELRRLWSEEQHIPGIPLDETPDLNSCLLYQQLQVINCCLSRKRRHTIATESLESVMRQCSSNVEDSSPC… |
| A0A7E4SGC5 | 27-331 | None |
| A0A2C9WG00 | 66-282 | None |
| A0A287HXG4 | 205-444 | None |
| A0A287HX67 | 174-497 | None |
| K3WCV3 | 463-685 | None |
| A0A5B8MH94 | 308-588 | None |
| A0A7I4CMN5 | 310-604 | None |
| A0A061RG24 | 11-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.