DPCstruct | MC33403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 495 ± 116 aa |
| Standard deviation of domain lengths | 115.86 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 81.55 |
| Assigned Pfam label(s) | CL0067- PF05622- CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8ZB44 | 87-601 | SRPRFRPMFISQNFGSCLENPNKLTDYEDLADGVLVYEVLLQIDPEPAHHGVLPSFGNALVRTRNMDIVIKNMKALYEEELCQVLLV… |
| A0A1B0DCV9 | 16-327 | TSLLDGAIINSVVLQIDPEPQHHLVKLIGLDGVLLANARARNFDAIVRNLRNLYEEELCQRVLILPDCSVLGHSPETPQGLEQMKLL… |
| A0A7M4F9L2 | 2-461 | None |
| A0A1Y1VDE2 | 9-467 | None |
| A0A1B0A799 | 8-451 | None |
| A0A6S7GDF3 | 35-589 | None |
| F4Q6U0 | 5-660 | None |
| A0A1B0BZT3 | 117-651 | None |
| B6AGJ8 | 1-579 | None |
| T1FWU2 | 18-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.