DPCstruct | MC33400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6GFC1 | 1-71 | MSRKVVIPERGSASFKSVIANLEWRVRLDPSIKHGDPRYNAALSIMASKISYENQPFIQNVLTHNWKGSYG |
| A0A5A7TWG7 | 71-137 | LQGKMEIPKAESEKFMSFIGQIDRRVELDSSIKAGDYRYFSSLTVMASKLSYENHAFVKITVQDHWK |
| A0A314YMK2 | 1-67 | None |
| A0A6A2YC74 | 36-95 | None |
| A0A396IXF3 | 73-139 | None |
| A0A453D681 | 3-79 | None |
| M5VW41 | 87-151 | None |
| A0A6A3A158 | 38-100 | None |
| A0A2P5CSU0 | 8-76 | None |
| M0ZE43 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.