DPCstruct | MC334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 163 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09786 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1H0T7 | 1-156 | MQIGNVGIERLKKTVENQPFISQHVPALPLVIPFLEMSANQEYLVKRIRDLAKGSCLADYRWNSGNSYHGLQWDEHLPTDSSILFHL… |
| A0A6P6XX23 | 346-511 | REIESINKLIVEKGYIDSMIGETPLKNLKQLAESRRTEFPTLEQVCPFLDISNVRNLENTIPLQEYLVRRLKDLAKGGCMIEFLWDG… |
| A0A0B2UVP3 | 574-741 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.