DPCstruct | MC33399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 12.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 56.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q016A2 | 1-101 | MAGKAKPKKHTAKELQAKAAAALTNKGGGAAGLVDRKGGAAGHAKFKCPVCGMAAPSEKSGIAHWDSKHPKLTFDFAQWTDQHAVHG… |
| A0A7J6GBM6 | 1-98 | MTGKAKPKKHTTKEIAAKIDAATTNRGGGKAGLADRSGIEKGGHAKFECPLCKTTVPDLKSMQIHHEARHPKIPFEEDKLVNRHSTV… |
| A0A6N2M7Y0 | 1-104 | None |
| A0A816VDU2 | 74-171 | None |
| A0A3P6FZB3 | 1-98 | None |
| A0A803L467 | 1-95 | None |
| T1LD99 | 1-67 | None |
| A0A6D2JC86 | 61-161 | None |
| A0A5N5KHC8 | 1-97 | None |
| A0A812UAX5 | 64-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.