DPCstruct | MC33395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9RWJ7 | 1-124 | MLGGATNVFGIIVIGLAIFSLANTYAQDIGWKGAAAIDQDPSGIAVVTIFSATPLDLAGGNVTASRAMTPEGIWAYRYSGAQLLTYS… |
| A0A0Q5N2R9 | 167-288 | LSRGSEKTLVFCLVTLLLFWGTSDFAQALGRGLAVSYEERSALLPTAVVYSKDRLGISAPNVREQYSGTAEHPVYQYSGLRLLVVSG… |
| A0A5J6HQH5 | 82-200 | None |
| A0A4R2GWU1 | 3-105 | None |
| A0A7Y6AGJ8 | 512-634 | None |
| A0A1H8Y806 | 41-167 | None |
| A0A428Z1S9 | 87-209 | None |
| A0A4R3RWQ6 | 263-392 | None |
| A0A8A3HN78 | 381-499 | None |
| A0A4Q3G3V0 | 200-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.