DPCstruct | MC33394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9S7N5 | 1-119 | MRYDQAAGLIDVVAGTGATLPAIAAAVNDPAALREVAPGEWQLGADLAVRGGAELQISAPEVRWLKLSSTPGRFVSVEALGGKLDVT… |
| A0A148N6B3 | 35-155 | NFKWSGETGILYVTGPVTCTLSDINTIGLHEVLEQVDPFNHVWILRANLHLKEGARLDLHGTSIGGDVDELRLASPGNFGNIHLRAE… |
| A0A0G0BMB7 | 528-659 | None |
| A0A7V4PDC1 | 79-199 | None |
| A0A852SNV5 | 181-291 | None |
| A0A0G0LGH8 | 543-677 | None |
| A0A2W4MMR6 | 683-821 | None |
| A0A6H5KU33 | 332-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.