DPCstruct | MC33391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 192 ± 14 aa |
| Standard deviation of domain lengths | 14.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6W7X2 | 3-197 | EGLEGREPELTEAANINVVLVADTDLLTDRMWVQVQDFFGQRIPQPWADNGGFLINALDNLSGSEALISVRSRGNFSRPFTVVEDLQ… |
| A0A7V6BE99 | 1-180 | VLVGDADLLNDQFCVRVQSILGQRFVIPVNGNLTLVQGLVEQMSGDLNLITIRGRATKNRPFEVVREIQAKAEEQYRSKLEELQKSL… |
| A0A848WS14 | 357-565 | None |
| A0A536W4C7 | 185-396 | None |
| A0A1F4DUV4 | 152-342 | None |
| A0A1Q6T1Z0 | 666-836 | None |
| A0A537QAL6 | 55-259 | None |
| A0A536XUY2 | 436-611 | None |
| A0A2H6AVN9 | 348-547 | None |
| A0A836WYU0 | 273-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.