DPCstruct | MC3339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 124 ± 7 aa |
| Standard deviation of domain lengths | 6.59 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 96.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 53.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14789 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3VKF5 | 52-174 | IESFDAPPVSTEDAYLRLHLLSERTVQPNAINLDGIFGWLPNVAWTSAGPVLPDKVDVLRDRVAAEFHHLTVASVDRFPRMTDYVVP… |
| A0A5Q2VY24 | 105-228 | LAAPPADTADAYLRLHLLSHRDIAPGEAELGGLEEVLPVNVWTSVGACELADFEDTRLRLRIAGKGVAPVVFGVARFPRMTDFVAPS… |
| A0A087BMY2 | 191-319 | None |
| A0A160NWL1 | 306-436 | None |
| A0A4P6MXX0 | 307-425 | None |
| A0A512NJ15 | 2-111 | None |
| S5STQ6 | 66-195 | None |
| A0A4R3Q4S5 | 64-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.