DPCstruct | MC33389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 222 ± 34 aa |
| Standard deviation of domain lengths | 33.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845C7W7 | 2-181 | LQLNCLTTYHAEIWNEFAPSYTQLGWSAAHMGLEQENPLKASHTWKRDCGLRTDRARRQALLEVDVLVAMSLGLTLDELIQIYRLVF… |
| A0A1X7LPG1 | 306-518 | ETIRDTVAASGFWASIPVDFFAKVAGVSDLTQNVIRRFPHIRQHSLEPQLLLRALRLNCLIRPYAPLWEELYEIEWQQDSWVPHIGV… |
| A0A5B8RWL1 | 203-468 | None |
| A0A839D5G5 | 233-527 | None |
| A0A0G3HAT1 | 1-201 | None |
| A0A7Y1UWE4 | 1-159 | None |
| K0Z5F5 | 26-231 | None |
| A0A7Z8IH15 | 6-199 | None |
| A0A352IGF0 | 487-720 | None |
| A0A2T4NAN1 | 831-1057 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.