DPCstruct | MC33388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 188 ± 40 aa |
| Standard deviation of domain lengths | 39.57 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845C7H7 | 13-201 | QARPGPRARRIQVIDALRGFALLGILPMNMISFANPDWILFNPTVHGSFEGVEKWIWVVSHVLADQKFMTIFSPLYGAGILLFTANL… |
| A0A8B4PUN5 | 2-205 | ERNVTLDFVRGVAILGILLLNISAFGLPKAAYLNPAWSGNISASDAWTWAILDLLAQVKFLTLFALLFGAGLQLLLPRGKRWIQSRL… |
| A0A2T4V135 | 11-178 | None |
| R8DUJ3 | 5-129 | None |
| Q9KE12 | 1-185 | None |
| A0A7C8CWW9 | 4-221 | None |
| A0A852TEH4 | 15-223 | None |
| A0A6C0GFX4 | 1-166 | None |
| A0A386ZLB2 | 15-219 | None |
| A0A2M8D588 | 17-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.