DPCstruct | MC33386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849B8L8 | 4-112 | KKIAPRAAFEMQKRNAQSRGIGWELTFEQWWEIWEPVYHLRGRGKNGLCMGRERDEGPYAVGNVYITTNLGNMMDYHRRGKRVDKKR… |
| A0A2I8XM42 | 5-90 | SRKVKEAYESQRTMAKTRGLDWGFTLETWAEIWRPHWENRGKLRHQLCMGRKGDQGGYTPDNVYIITNRENSLETLERREYDSKEF |
| A0A2D9C3W1 | 37-113 | None |
| A0A512C543 | 16-110 | None |
| A0A6S7B3M9 | 21-115 | None |
| A0A2S9MYL0 | 3-107 | None |
| A0A6L4BBZ8 | 1-102 | None |
| A0A855GI17 | 96-177 | None |
| A0A7H5F483 | 1-82 | None |
| A0A0F9C611 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.