DPCstruct | MC33385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 467 |
|---|---|
| Mean domain length (aa) | 154 ± 26 aa |
| Standard deviation of domain lengths | 25.86 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.35 |
| Pfam Score | 97.23 |
| Assigned Pfam label(s) | PF14774- CL0673- CL0127- PF04757- PF06271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5XJP1 | 3-139 | RPAGSGWRLLARVVDSLLVGFVGSLVLWTVLGFPDYGSAPGLLYSGLVALLYLVYEGVMLSRDGQTVGKKLVRIRVAMLADGSSPPA… |
| A0A2N2P197 | 5-175 | YAGLWTRILAFGFDYLPIAIYLGVVVMLGLALGAAFPELQQVVFGNPVSGQIAGFFIVTVPISLYFVLFESSAWQATWGKRKRHLQV… |
| A0A221R1R0 | 18-172 | None |
| A0A401FIK8 | 2-132 | None |
| A0A3D2C8C4 | 4-127 | None |
| A0A7V3ADE4 | 382-537 | None |
| A0A1W1XV48 | 90-231 | None |
| A0A519MXZ7 | 154-298 | None |
| A0A356FXV1 | 5-147 | None |
| A0A0G1FLC7 | 94-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.