DPCstruct | MC33383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0X7B0 | 1-112 | MCAPEDDPNYTIAYQAAANALNHGIDYANGGCFWDGNDLKSDGKKHDKYRAGFTYTSPEHNIFHTPEPPPKHRHSTHGVYNYAYEST… |
| A0A0W0TQN5 | 94-203 | SNLEMDFPVLNEIALNALDPNGVDYSNGGCFWDGNDLKTAGTKHLHYPWGYKFTNPSHDVLNIGDTPPMNLEGDLGNYDYTLESTAG… |
| A0A132HMV9 | 1-132 | None |
| A0A0W0R1J9 | 209-315 | None |
| A0A3A5LFS3 | 124-235 | None |
| A0A0U3LRP2 | 47-171 | None |
| Q5ZSZ3 | 120-223 | None |
| E1KNI2 | 275-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.