DPCstruct | MC33377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7XB07 | 25-120 | KCEVNLQLWLSNKRSLSPWGYSINHDPTRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPMPPRTGPCRQRAVM… |
| A0A183IHD9 | 2-86 | TNTLGLCNFCSAMRILPSNYYPRFINEVVCDDNDTGCLSNYGFCKPKSRAVEVFVNNGTQENAIWTKVFIIISVSCECYVQDGSE |
| A0A6V7VXL5 | 200-314 | None |
| A0A0M3IJ72 | 13-110 | None |
| A0A2I4C366 | 90-194 | None |
| A0A6I8SHS0 | 185-283 | None |
| A0A2G8LPA6 | 118-198 | None |
| W5M210 | 9-104 | None |
| A0A6I9IWU8 | 8-102 | None |
| A0A667HLX5 | 335-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.