DPCstruct | MC3337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 213 ± 24 aa |
| Standard deviation of domain lengths | 24.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6UN33 | 28-262 | IAPAAYADELVQTVSVADFGAKADSKQDAAEPVKAAIAKAKTMAEKGASVRIVFPAGRYDIYPDKAPQRTLYVSNTVGADASYKEKR… |
| A0A4R8DHS5 | 478-685 | LVSVVTDPLKNGSPALKKAAEACKGARVLSLPGGRIDLWPEGSVQKELYISNATEDDTLPKIKHIALCLENVHHLVVEGHHTLLVLH… |
| A0A7C7YFH6 | 26-239 | None |
| A0A1F6EHY9 | 485-682 | None |
| I6AT99 | 19-233 | None |
| A0A292FV73 | 4-249 | None |
| A0A817RVD9 | 20-180 | None |
| A0A402CUI5 | 1-207 | None |
| A0A383TW23 | 2-230 | None |
| A0A6P1MDG5 | 468-651 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.